Lineage for d1vspt1 (1vsp T:3-179)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805051Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 805052Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 805053Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 805088Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 805100Species Thermus thermophilus [TaxId:274] [63799] (12 PDB entries)
  8. 805109Domain d1vspt1: 1vsp T:3-179 [145800]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspz1
    automatically matched to 2J01 Z:3-179

Details for d1vspt1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (T:) 50S ribosomal protein L25

SCOP Domain Sequences for d1vspt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspt1 b.53.1.1 (T:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOP Domain Coordinates for d1vspt1:

Click to download the PDB-style file with coordinates for d1vspt1.
(The format of our PDB-style files is described here.)

Timeline for d1vspt1: