![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159025] (11 PDB entries) Uniprot Q72I15 2-102 |
![]() | Domain d1vsps1: 1vsp S:2-102 [145799] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vspt1, d1vspz1 automatically matched to 2J01 Y:2-102 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOP Domain Sequences for d1vsps1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsps1 b.34.5.1 (S:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
Timeline for d1vsps1: