Lineage for d1vspp1 (1vsp P:1-101)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433987Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 2433988Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 2433989Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 2433990Protein Ribosomal protein L21p [141093] (3 species)
  7. 2434026Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
    Uniprot P60492 1-101
  8. 2434035Domain d1vspp1: 1vsp P:1-101 [145798]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vsps1, d1vspt1, d1vspz1

Details for d1vspp1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (P:) 50S ribosomal protein L21

SCOPe Domain Sequences for d1vspp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspp1 b.155.1.1 (P:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOPe Domain Coordinates for d1vspp1:

Click to download the PDB-style file with coordinates for d1vspp1.
(The format of our PDB-style files is described here.)

Timeline for d1vspp1: