![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) ![]() |
![]() | Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
![]() | Protein Ribosomal protein L20 [74733] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158510] (11 PDB entries) Uniprot P60491 1-117 |
![]() | Domain d1vspo1: 1vsp O:2-118 [145797] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspp1, d1vsps1, d1vspt1, d1vspz1 automatically matched to 2J01 U:2-118 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspo1 a.144.2.1 (O:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
Timeline for d1vspo1: