Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries) Uniprot Q72I23 5-150 |
Domain d1vspj1: 1vsp J:5-150 [145796] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1 automatically matched to 2J01 P:5-150 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspj1 c.12.1.1 (J:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]} dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk vvahafsksaleklkaaggepvllea
Timeline for d1vspj1: