SCOPe 2.07: Domain d1vspf2: 1vsp F:83-171

Lineage for d1vspf2 (1vsp F:83-171)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d1vspf2: 1vsp F:83-171 [145794]
   Other proteins in same PDB: d1vspa1, d1vspc1, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1

Details for d1vspf2

PDB Entry: 1vsp, 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH

PDB Compounds: (F:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1vspf2:

Sequence; same for both SEQRES and ATOM records:

>d1vspf2 d.141.1.1 (F:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

Timeline for d1vspf2:

• d1vspf2 first appeared in SCOP 1.75
  
• d1vspf2 appears in SCOPe 2.06
  
• d1vspf2 appears in the current release, SCOPe 2.08