Lineage for d1vspf2 (1vsp F:83-171)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873861Species Thermus thermophilus [TaxId:274] [160797] (11 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 873875Domain d1vspf2: 1vsp F:83-171 [145794]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1
    automatically matched to 2J01 H:83-171

Details for d1vspf2

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (F:) 50S ribosomal protein L6

SCOP Domain Sequences for d1vspf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspf2 d.141.1.1 (F:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

SCOP Domain Coordinates for d1vspf2:

Click to download the PDB-style file with coordinates for d1vspf2.
(The format of our PDB-style files is described here.)

Timeline for d1vspf2: