Lineage for d1vspc1 (1vsp C:3-203)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952274Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 952275Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 952375Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries)
    Uniprot Q72I04 1-205
  8. 952384Domain d1vspc1: 1vsp C:3-203 [145792]
    Other proteins in same PDB: d1vspa1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1
    automatically matched to 2J01 E:1-205

Details for d1vspc1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (C:) 50S ribosomal protein L3

SCOPe Domain Sequences for d1vspc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspc1 b.43.3.2 (C:3-203) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]}
gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp
lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf
aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll
lvkgavpgpngglvivretkk

SCOPe Domain Coordinates for d1vspc1:

Click to download the PDB-style file with coordinates for d1vspc1.
(The format of our PDB-style files is described here.)

Timeline for d1vspc1: