Lineage for d1vspa1 (1vsp A:6-229)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625308Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2625309Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2625310Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2625311Protein Ribosomal protein L1 [56810] (4 species)
  7. 2625322Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 2625334Domain d1vspa1: 1vsp A:6-229 [145791]
    Other proteins in same PDB: d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1

Details for d1vspa1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (A:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1vspa1:

Sequence, based on SEQRES records: (download)

>d1vspa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

Sequence, based on observed residues (ATOM records): (download)

>d1vspa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi
efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps
vrinphs

SCOPe Domain Coordinates for d1vspa1:

Click to download the PDB-style file with coordinates for d1vspa1.
(The format of our PDB-style files is described here.)

Timeline for d1vspa1: