SCOP 1.75: Domain d1vsna1: 1vsn A:1-211

Lineage for d1vsna1 (1vsn A:1-211)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (31 PDB entries)
   Uniprot P43235 116-329
   Uniprot P43235 115-329
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1vsna1: 1vsn A:1-211 [145790]
   complexed with nft

Details for d1vsna1

PDB Entry: 1vsn, 2 Å

PDB Description: crystal structure of a potent small molecule inhibitor bound to cathepsin k

PDB Compounds: (A:) cathepsin k

SCOP Domain Sequences for d1vsna1:

Sequence; same for both SEQRES and ATOM records:

>d1vsna1 d.3.1.1 (A:1-211) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkatgallnlapqnlvdcvsen
dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneaa
lkravaavgpvsvaidasltsfqfysagvyydencssdalnhavlavgygiqagnkhwii
knswgeswgnagyilmarnknnacgianlasfpkm

Timeline for d1vsna1:

• d1vsna1 is new in SCOP 1.75
  
• d1vsna1 appears in SCOPe 2.01
  
• d1vsna1 appears in the current release, SCOPe 2.08