Lineage for d1vsna1 (1vsn A:1-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926617Protein (Pro)cathepsin K [54028] (3 species)
  7. 2926618Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2926652Domain d1vsna1: 1vsn A:1-211 [145790]
    complexed with nft

Details for d1vsna1

PDB Entry: 1vsn (more details), 2 Å

PDB Description: crystal structure of a potent small molecule inhibitor bound to cathepsin k
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1vsna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsna1 d.3.1.1 (A:1-211) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkatgallnlapqnlvdcvsen
dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneaa
lkravaavgpvsvaidasltsfqfysagvyydencssdalnhavlavgygiqagnkhwii
knswgeswgnagyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d1vsna1:

Click to download the PDB-style file with coordinates for d1vsna1.
(The format of our PDB-style files is described here.)

Timeline for d1vsna1: