SCOPe 2.08: Domain d1uz3b_: 1uz3 B:

Lineage for d1uz3b_ (1uz3 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.283: ENT-like [158638] (1 superfamily)
   5 helices, irregular array, right-handed superhelix

4. Superfamily a.283.1: ENT-like [158639] (1 family)

5. Family a.283.1.1: Emsy N terminal (ENT) domain-like [158640] (2 proteins)
   Pfam PF03735

6. Protein automated matches [254434] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254911] (1 PDB entry)

8. Domain d1uz3b_: 1uz3 B: [145787]
   automated match to d1utub_

Details for d1uz3b_

PDB Entry: 1uz3, 1.1 Å

PDB Description: crystal structure of novel protein emsy

PDB Compounds: (B:) emsy protein

SCOPe Domain Sequences for d1uz3b_:

Sequence; same for both SEQRES and ATOM records:

>d1uz3b_ a.283.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsiste
rhraevrravnderlttiahnmsgpnsssewsiegrr

Timeline for d1uz3b_:

• d1uz3b_ first appeared in SCOP 1.75, called d1uz3b1
  
• d1uz3b_ appears in SCOPe 2.07