Lineage for d1uz3a_ (1uz3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739143Fold a.283: ENT-like [158638] (1 superfamily)
    5 helices, irregular array, right-handed superhelix
  4. 2739144Superfamily a.283.1: ENT-like [158639] (1 family) (S)
  5. 2739145Family a.283.1.1: Emsy N terminal (ENT) domain-like [158640] (2 proteins)
    Pfam PF03735
  6. 2739151Protein automated matches [254434] (1 species)
    not a true protein
  7. 2739152Species Human (Homo sapiens) [TaxId:9606] [254911] (1 PDB entry)
  8. 2739153Domain d1uz3a_: 1uz3 A: [145786]
    automated match to d1utub_

Details for d1uz3a_

PDB Entry: 1uz3 (more details), 1.1 Å

PDB Description: crystal structure of novel protein emsy
PDB Compounds: (A:) emsy protein

SCOPe Domain Sequences for d1uz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz3a_ a.283.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsi
sterhraevrravnderlttiahnmsgpnsssewsiegrrlv

SCOPe Domain Coordinates for d1uz3a_:

Click to download the PDB-style file with coordinates for d1uz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1uz3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uz3b_