SCOPe 2.07: Domain d1uz3a_: 1uz3 A:

Lineage for d1uz3a_ (1uz3 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.283: ENT-like [158638] (1 superfamily)
   5 helices, irregular array, right-handed superhelix

4. Superfamily a.283.1: ENT-like [158639] (1 family)

5. Family a.283.1.1: Emsy N terminal (ENT) domain-like [158640] (2 protein domains)
   Pfam PF03735

6. Protein automated matches [254434] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254911] (1 PDB entry)

8. Domain d1uz3a_: 1uz3 A: [145786]
   automated match to d1utub_

Details for d1uz3a_

PDB Entry: 1uz3, 1.1 Å

PDB Description: crystal structure of novel protein emsy

PDB Compounds: (A:) emsy protein

SCOPe Domain Sequences for d1uz3a_:

Sequence; same for both SEQRES and ATOM records:

>d1uz3a_ a.283.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsi
sterhraevrravnderlttiahnmsgpnsssewsiegrrlv

Timeline for d1uz3a_:

• d1uz3a_ first appeared in SCOP 1.75, called d1uz3a1
  
• d1uz3a_ appears in SCOPe 2.06