![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.283: ENT-like [158638] (1 superfamily) 5 helices, irregular array, right-handed superhelix |
![]() | Superfamily a.283.1: ENT-like [158639] (1 family) ![]() |
![]() | Family a.283.1.1: Emsy N terminal (ENT) domain-like [158640] (2 proteins) Pfam PF03735 |
![]() | Protein automated matches [254434] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254911] (1 PDB entry) |
![]() | Domain d1uz3a_: 1uz3 A: [145786] automated match to d1utub_ |
PDB Entry: 1uz3 (more details), 1.1 Å
SCOPe Domain Sequences for d1uz3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz3a_ a.283.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsmpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsi sterhraevrravnderlttiahnmsgpnsssewsiegrrlv
Timeline for d1uz3a_: