Lineage for d1u88b2 (1u88 B:5-81)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876743Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
    Uniprot P08515
  8. 2876763Domain d1u88b2: 1u88 B:5-81 [145783]
    Other proteins in same PDB: d1u88a1, d1u88b1
    automatically matched to d2fhea2
    complexed with gty; mutant

Details for d1u88b2

PDB Entry: 1u88 (more details), 3.5 Å

PDB Description: crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with s-octyl glutathione
PDB Compounds: (B:) Glutathione S-Transferase 26 kDa

SCOPe Domain Sequences for d1u88b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u88b2 c.47.1.5 (B:5-81) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk
ltqsmaiiryiadkhnm

SCOPe Domain Coordinates for d1u88b2:

Click to download the PDB-style file with coordinates for d1u88b2.
(The format of our PDB-style files is described here.)

Timeline for d1u88b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u88b1