Lineage for d1u87a2 (1u87 A:5-81)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833733Protein Class alpha GST [81360] (8 species)
  7. 833830Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries)
    Uniprot P08515
  8. 833842Domain d1u87a2: 1u87 A:5-81 [145779]
    Other proteins in same PDB: d1u87a1
    automatically matched to d2fhea2
    complexed with gsw; mutant

Details for d1u87a2

PDB Entry: 1u87 (more details), 3.5 Å

PDB Description: crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with glutathione
PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOP Domain Sequences for d1u87a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u87a2 c.47.1.5 (A:5-81) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk
ltqsmaiiryiadkhnm

SCOP Domain Coordinates for d1u87a2:

Click to download the PDB-style file with coordinates for d1u87a2.
(The format of our PDB-style files is described here.)

Timeline for d1u87a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u87a1