Lineage for d1tota1 (1tot A:1-52)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1706894Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1706895Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1707009Family g.44.1.6: ZZ domain [161211] (3 proteins)
    Pfam PF00569
  6. 1707010Protein CREB-binding protein, CBP [161212] (1 species)
  7. 1707011Species Mouse (Mus musculus) [TaxId:10090] [161213] (1 PDB entry)
    Uniprot P45481 1700-1751
  8. 1707012Domain d1tota1: 1tot A:1-52 [145777]
    complexed with zn

Details for d1tota1

PDB Entry: 1tot (more details)

PDB Description: zz domain of cbp- a novel fold for a protein interaction module
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d1tota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]}
gqdrfvytcneckhhvetrwhctvcedydlcincyntkshthkmvkwglgld

SCOPe Domain Coordinates for d1tota1:

Click to download the PDB-style file with coordinates for d1tota1.
(The format of our PDB-style files is described here.)

Timeline for d1tota1: