Lineage for d1teya1 (1tey A:1-156)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 789716Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 789717Family b.1.22.1: ASF1-like [101547] (1 protein)
  6. 789718Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 789723Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
    Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156
  8. 789727Domain d1teya1: 1tey A:1-156 [145776]

Details for d1teya1

PDB Entry: 1tey (more details)

PDB Description: NMR structure of human histone chaperone, ASF1A
PDB Compounds: (A:) ASF1 anti-silencing function 1 homolog A

SCOP Domain Sequences for d1teya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teya1 b.1.22.1 (A:1-156) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwedn

SCOP Domain Coordinates for d1teya1:

Click to download the PDB-style file with coordinates for d1teya1.
(The format of our PDB-style files is described here.)

Timeline for d1teya1: