SCOPe 2.08: Domain d1teya1: 1tey A:1-156

Lineage for d1teya1 (1tey A:1-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
   Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156

8. Domain d1teya1: 1tey A:1-156 [145776]

Details for d1teya1

PDB Entry: 1tey

PDB Description: nmr structure of human histone chaperone, asf1a

PDB Compounds: (A:) ASF1 anti-silencing function 1 homolog A

SCOPe Domain Sequences for d1teya1:

Sequence; same for both SEQRES and ATOM records:

>d1teya1 b.1.22.1 (A:1-156) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwedn

Timeline for d1teya1:

• d1teya1 first appeared in SCOP 1.75
  
• d1teya1 appears in SCOPe 2.07