Lineage for d1qw1a1 (1qw1 A:130-226)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796061Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 796101Family b.34.1.2: FeoA-like [50041] (4 proteins)
  6. 796102Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 796103Species Corynebacterium diphtheriae [TaxId:1717] [50043] (15 PDB entries)
    Uniprot P33120
  8. 796120Domain d1qw1a1: 1qw1 A:130-226 [145772]
    automatically matched to d1byma_

Details for d1qw1a1

PDB Entry: 1qw1 (more details)

PDB Description: solution structure of the c-terminal domain of dtxr residues 110-226
PDB Compounds: (A:) diphtheria toxin repressor

SCOP Domain Sequences for d1qw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw1a1 b.34.1.2 (A:130-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
gseveivdrdghitlshngkdvellddlahtirieel

SCOP Domain Coordinates for d1qw1a1:

Click to download the PDB-style file with coordinates for d1qw1a1.
(The format of our PDB-style files is described here.)

Timeline for d1qw1a1: