![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (4 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [50043] (15 PDB entries) Uniprot P33120 |
![]() | Domain d1qw1a1: 1qw1 A:130-226 [145772] automatically matched to d1byma_ |
PDB Entry: 1qw1 (more details)
SCOP Domain Sequences for d1qw1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qw1a1 b.34.1.2 (A:130-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv gseveivdrdghitlshngkdvellddlahtirieel
Timeline for d1qw1a1: