SCOPe 2.08: Domain d1qw1a1: 1qw1 A:130-226

Lineage for d1qw1a1 (1qw1 A:130-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d1qw1a1: 1qw1 A:130-226 [145772]
   Other proteins in same PDB: d1qw1a2
   automatically matched to d1byma_

Details for d1qw1a1

PDB Entry: 1qw1

PDB Description: solution structure of the c-terminal domain of dtxr residues 110-226

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1qw1a1:

Sequence; same for both SEQRES and ATOM records:

>d1qw1a1 b.34.1.2 (A:130-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
gseveivdrdghitlshngkdvellddlahtirieel

Timeline for d1qw1a1:

• d1qw1a1 first appeared in SCOP 1.75
  
• d1qw1a1 appears in SCOPe 2.07