![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.22: Autophagin-like [159858] (3 proteins) Pfam PF03416 |
![]() | Protein automated matches [190846] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188165] (3 PDB entries) |
![]() | Domain d2z0ea_: 2z0e A: [145770] Other proteins in same PDB: d2z0eb_ automated match to d2z0da1 |
PDB Entry: 2z0e (more details), 1.9 Å
SCOPe Domain Sequences for d2z0ea_:
Sequence, based on SEQRES records: (download)
>d2z0ea_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaigg tgptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyy sihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlc rtsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetl khcfmmpqslgviggkpnsahyfigyvgeeliyldpattqpaveptdgcfipdesfhcqh ppcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq
>d2z0ea_ d.3.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaigg tgptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyy sihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlc rtspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeel iyldpattqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkkl sllggalpmfelveq
Timeline for d2z0ea_: