Lineage for d2uy7h_ (2uy7 H:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112822Protein automated matches [190569] (5 species)
    not a true protein
  7. 1112823Species Escherichia coli [TaxId:562] [188033] (3 PDB entries)
  8. 1112829Domain d2uy7h_: 2uy7 H: [145767]
    Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7b1, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2
    automated match to d2uy7b1
    complexed with so4

Details for d2uy7h_

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (H:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy7h_:

Sequence, based on SEQRES records: (download)

>d2uy7h_ b.2.3.2 (H:) automated matches {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg
envlhytavvkkssavgaavtegafsavanfnltyq

Sequence, based on observed residues (ATOM records): (download)

>d2uy7h_ b.2.3.2 (H:) automated matches {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdgen
vlhytavvkkssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy7h_:

Click to download the PDB-style file with coordinates for d2uy7h_.
(The format of our PDB-style files is described here.)

Timeline for d2uy7h_: