![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
![]() | Protein automated matches [190569] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [188033] (2 PDB entries) |
![]() | Domain d2uy7h_: 2uy7 H: [145767] Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7b1, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2 automated match to d2uy7b1 complexed with so4 |
PDB Entry: 2uy7 (more details), 2.6 Å
SCOPe Domain Sequences for d2uy7h_:
Sequence, based on SEQRES records: (download)
>d2uy7h_ b.2.3.2 (H:) automated matches {Escherichia coli [TaxId: 562]} qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg envlhytavvkkssavgaavtegafsavanfnltyq
>d2uy7h_ b.2.3.2 (H:) automated matches {Escherichia coli [TaxId: 562]} qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk ggakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdgen vlhytavvkkssavgaavtegafsavanfnltyq
Timeline for d2uy7h_: