SCOP 1.75: Domain d2uy7f1: 2uy7 F:8-163

Lineage for d2uy7f1 (2uy7 F:8-163)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (8 proteins)

6. Protein Pap fimbrial major pilin protein PapA [158926] (1 species)

7. Species Escherichia coli [TaxId:562] [158927] (2 PDB entries)
   Uniprot P04127 30-185! Uniprot P04127 32-185

8. Domain d2uy7f1: 2uy7 F:8-163 [145766]
   Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2
   automatically matched to 2UY7 B:8-163
   complexed with so4; mutant

Details for d2uy7f1

PDB Entry: 2uy7, 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (F:) pap fimbrial major pilin protein

SCOP Domain Sequences for d2uy7f1:

Sequence; same for both SEQRES and ATOM records:

>d2uy7f1 b.2.3.2 (F:8-163) Pap fimbrial major pilin protein PapA {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg
envlhytavvkkssavgaavtegafsavanfnltyq

Timeline for d2uy7f1:

• d2uy7f1 is new in SCOP 1.75
  
• d2uy7f1 is called d2uy7f_ in SCOPe 2.01
  
• d2uy7f1 appears in the current release, SCOPe 2.08, called d2uy7f_