Lineage for d2uy7f_ (2uy7 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767677Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)
  8. 2767686Domain d2uy7f_: 2uy7 F: [145766]
    Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7b1, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2
    automated match to d2uy7b1
    complexed with so4

Details for d2uy7f_

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (F:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7f_ b.2.3.2 (F:) automated matches {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg
envlhytavvkkssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy7f_:

Click to download the PDB-style file with coordinates for d2uy7f_.
(The format of our PDB-style files is described here.)

Timeline for d2uy7f_: