Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
Protein automated matches [190569] (10 species) not a true protein |
Species Escherichia coli [TaxId:562] [188033] (6 PDB entries) |
Domain d2uy7d_: 2uy7 D: [145765] Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7b1, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2 automated match to d2uy7b1 complexed with so4 |
PDB Entry: 2uy7 (more details), 2.6 Å
SCOPe Domain Sequences for d2uy7d_:
Sequence, based on SEQRES records: (download)
>d2uy7d_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 562]} qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg envlhytavvkkssavgaavtegafsavanfnltyq
>d2uy7d_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 562]} qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk ggakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdgen vlhytavvkkssavgaavtegafsavanfnltyq
Timeline for d2uy7d_: