Lineage for d2uy7d_ (2uy7 D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300809Protein automated matches [190569] (7 species)
    not a true protein
  7. 1300817Species Escherichia coli [TaxId:562] [188033] (4 PDB entries)
  8. 1300821Domain d2uy7d_: 2uy7 D: [145765]
    Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7b1, d2uy7c1, d2uy7c2, d2uy7e1, d2uy7e2, d2uy7g1, d2uy7g2
    automated match to d2uy7b1
    complexed with so4

Details for d2uy7d_

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (D:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy7d_:

Sequence, based on SEQRES records: (download)

>d2uy7d_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg
envlhytavvkkssavgaavtegafsavanfnltyq

Sequence, based on observed residues (ATOM records): (download)

>d2uy7d_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 562]}
qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk
ggakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdgen
vlhytavvkkssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy7d_:

Click to download the PDB-style file with coordinates for d2uy7d_.
(The format of our PDB-style files is described here.)

Timeline for d2uy7d_: