Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein Pap fimbrial major pilin protein PapA [158926] (1 species) |
Species Escherichia coli [TaxId:562] [158927] (2 PDB entries) Uniprot P04127 30-185! Uniprot P04127 32-185 |
Domain d2uy7b1: 2uy7 B:8-163 [145764] Other proteins in same PDB: d2uy7a1, d2uy7a2, d2uy7c1, d2uy7c2, d2uy7d_, d2uy7e1, d2uy7e2, d2uy7f_, d2uy7g1, d2uy7g2, d2uy7h_ complexed with so4 |
PDB Entry: 2uy7 (more details), 2.6 Å
SCOPe Domain Sequences for d2uy7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy7b1 b.2.3.2 (B:8-163) Pap fimbrial major pilin protein PapA {Escherichia coli [TaxId: 562]} qgkvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafk ggngakkgtvklaftgpivnghsdeldtnggtgtaivvqgagknvvfdgsegdantlkdg envlhytavvkkssavgaavtegafsavanfnltyq
Timeline for d2uy7b1: