Lineage for d2uy6b1 (2uy6 B:10-163)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112798Protein Pap fimbrial major pilin protein PapA [158926] (1 species)
  7. 1112799Species Escherichia coli [TaxId:562] [158927] (2 PDB entries)
    Uniprot P04127 30-185! Uniprot P04127 32-185
  8. 1112800Domain d2uy6b1: 2uy6 B:10-163 [145763]
    Other proteins in same PDB: d2uy6a1, d2uy6a2, d2uy6c_

Details for d2uy6b1

PDB Entry: 2uy6 (more details), 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (B:) pap fimbrial major pilin protein

SCOPe Domain Sequences for d2uy6b1:

Sequence, based on SEQRES records: (download)

>d2uy6b1 b.2.3.2 (B:10-163) Pap fimbrial major pilin protein PapA {Escherichia coli [TaxId: 562]}
kvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafkgg
ngakkgtvklaftgpivnghsdeldtnggtglaivvqgagknvvfdgsegdantlkdgen
vlhytavvkkssavgaavtegafsavanfnltyq

Sequence, based on observed residues (ATOM records): (download)

>d2uy6b1 b.2.3.2 (B:10-163) Pap fimbrial major pilin protein PapA {Escherichia coli [TaxId: 562]}
kvtfnntvvdapcsisqksadqsidfgqlsksfleaggvskpmdldielvncditafkgg
kgtvklaftgpivnghsdeldtnggtglaivvqgagknvvfdgsegdantlkdgenvlhy
tavvkkssavgaavtegafsavanfnltyq

SCOPe Domain Coordinates for d2uy6b1:

Click to download the PDB-style file with coordinates for d2uy6b1.
(The format of our PDB-style files is described here.)

Timeline for d2uy6b1: