Lineage for d2uxna2 (2uxn A:274-654,A:764-836)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109396Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2109481Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 2109482Species Human (Homo sapiens) [TaxId:9606] [159433] (27 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 2109491Domain d2uxna2: 2uxn A:274-654,A:764-836 [145761]
    Other proteins in same PDB: d2uxna1, d2uxna3, d2uxnb1
    automatically matched to 2IW5 A:274-654,A:764-836
    complexed with cl, fda, gol

Details for d2uxna2

PDB Entry: 2uxn (more details), 2.72 Å

PDB Description: structural basis of histone demethylation by lsd1 revealed by suicide inactivation
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2uxna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxna2 c.3.1.2 (A:274-654,A:764-836) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflgamytl

SCOPe Domain Coordinates for d2uxna2:

Click to download the PDB-style file with coordinates for d2uxna2.
(The format of our PDB-style files is described here.)

Timeline for d2uxna2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2uxnb1