Lineage for d2uuyb1 (2uuy B:24-74)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259680Family g.8.1.3: Tick tryptase inhibitor-like [161132] (2 proteins)
  6. 2259681Protein Tryptase inhibitor [161133] (1 species)
  7. 2259682Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [161134] (1 PDB entry)
    Uniprot Q1EG59 45-95
  8. 2259683Domain d2uuyb1: 2uuy B:24-74 [145758]
    Other proteins in same PDB: d2uuya_
    complexed with ca, cl

Details for d2uuyb1

PDB Entry: 2uuy (more details), 1.15 Å

PDB Description: structure of a tick tryptase inhibitor in complex with bovine trypsin
PDB Compounds: (B:) tryptase inhibitor

SCOPe Domain Sequences for d2uuyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuyb1 g.8.1.3 (B:24-74) Tryptase inhibitor {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]}
ctvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncp

SCOPe Domain Coordinates for d2uuyb1:

Click to download the PDB-style file with coordinates for d2uuyb1.
(The format of our PDB-style files is described here.)

Timeline for d2uuyb1: