![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.3: Tick tryptase inhibitor-like [161132] (2 proteins) |
![]() | Protein Tryptase inhibitor [161133] (1 species) |
![]() | Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [161134] (1 PDB entry) Uniprot Q1EG59 45-95 |
![]() | Domain d2uuyb1: 2uuy B:24-74 [145758] Other proteins in same PDB: d2uuya_ complexed with ca, cl |
PDB Entry: 2uuy (more details), 1.15 Å
SCOPe Domain Sequences for d2uuyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuyb1 g.8.1.3 (B:24-74) Tryptase inhibitor {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]} ctvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncp
Timeline for d2uuyb1: