Lineage for d2pkqt2 (2pkq T:149-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568332Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2568477Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 2568511Domain d2pkqt2: 2pkq T:149-312 [145753]
    Other proteins in same PDB: d2pkqo1, d2pkqp1, d2pkqp3, d2pkqq1, d2pkqr1, d2pkqr3, d2pkqs1, d2pkqt1
    automatically matched to 2PKQ O:149-312
    complexed with ndp, so4

Details for d2pkqt2

PDB Entry: 2pkq (more details), 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp
PDB Compounds: (T:) Glyceraldehyde-3-phosphate dehydrogenase B

SCOPe Domain Sequences for d2pkqt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkqt2 d.81.1.1 (T:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldeelgivkgtmttthsytgdqrlldashrdlrraraaalnivptstg
aakavslvlpqlkgklngialrvptpnvsvvdlvvniekvgvtaedvnnafrkaaagplk
gvldvcdiplvsvdfrcsdfsstidssltmvmggdmvkvvawyd

SCOPe Domain Coordinates for d2pkqt2:

Click to download the PDB-style file with coordinates for d2pkqt2.
(The format of our PDB-style files is described here.)

Timeline for d2pkqt2: