Lineage for d2pkqt1 (2pkq T:0-148,T:313-333)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452132Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2452277Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
    Uniprot P19866
  8. 2452311Domain d2pkqt1: 2pkq T:0-148,T:313-333 [145752]
    Other proteins in same PDB: d2pkqo2, d2pkqp2, d2pkqp3, d2pkqq2, d2pkqr2, d2pkqr3, d2pkqs2, d2pkqt2
    automatically matched to 2PKQ O:0-148,O:313-333
    complexed with ndp, so4

Details for d2pkqt1

PDB Entry: 2pkq (more details), 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp
PDB Compounds: (T:) Glyceraldehyde-3-phosphate dehydrogenase B

SCOPe Domain Sequences for d2pkqt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkqt1 c.2.1.3 (T:0-148,T:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
itapakgsdiptyvvgvnekdyghdvaniisnasXnewgysqrvvdladlvankwp

SCOPe Domain Coordinates for d2pkqt1:

Click to download the PDB-style file with coordinates for d2pkqt1.
(The format of our PDB-style files is described here.)

Timeline for d2pkqt1: