SCOPe 2.03: Domain d2pkqq1: 2pkq Q:0-148,Q:313-333

Lineage for d2pkqq1 (2pkq Q:0-148,Q:313-333)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
   Uniprot P19866

8. Domain d2pkqq1: 2pkq Q:0-148,Q:313-333 [145750]
   Other proteins in same PDB: d2pkqo2, d2pkqp2, d2pkqq2, d2pkqr2, d2pkqs2, d2pkqt2
   automatically matched to 2PKQ O:0-148,O:313-333
   complexed with ndp, so4

Details for d2pkqq1

PDB Entry: 2pkq, 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp

PDB Compounds: (Q:) Glyceraldehyde-3-phosphate dehydrogenase B

SCOPe Domain Sequences for d2pkqq1:

Sequence; same for both SEQRES and ATOM records:

>d2pkqq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
itapakgsdiptyvvgvnekdyghdvaniisnasXnewgysqrvvdladlvankwp

Timeline for d2pkqq1:

• d2pkqq1 first appeared in SCOP 1.75
  
• d2pkqq1 appears in SCOPe 2.02
  
• d2pkqq1 appears in SCOPe 2.04
  
• d2pkqq1 appears in the current release, SCOPe 2.08