| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries) Uniprot P19866 |
| Domain d2pkqq1: 2pkq Q:0-148,Q:313-333 [145750] Other proteins in same PDB: d2pkqo2, d2pkqp2, d2pkqq2, d2pkqr2, d2pkqs2, d2pkqt2 automatically matched to 2PKQ O:0-148,O:313-333 complexed with ndp, so4 |
PDB Entry: 2pkq (more details), 3.6 Å
SCOP Domain Sequences for d2pkqq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkqq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
itapakgsdiptyvvgvnekdyghdvaniisnasXnewgysqrvvdladlvankwp
Timeline for d2pkqq1: