SCOPe 2.06: Domain d2pkgc1: 2pkg C:91-170

Lineage for d2pkgc1 (2pkg C:91-170)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.92: T-antigen specific domain-like [161239] (1 superfamily)
   all-alpha zinc-binding domain; there are two zinc ion-binding sites with a common CxCxxC motif but different fourth ligands

4. Superfamily g.92.1: T-antigen specific domain-like [161240] (1 family)
   automatically mapped to Pfam PF02380

5. Family g.92.1.1: T-antigen specific domain-like [161241] (1 protein)
   Pfam PF02380

6. Protein Small t antigen, ST-AG [161242] (1 species)

7. Species Simian virus 40 [TaxId:10633] [161243] (1 PDB entry)
   Uniprot P03081 91-170

8. Domain d2pkgc1: 2pkg C:91-170 [145746]
   Other proteins in same PDB: d2pkga1, d2pkgb1
   complexed with zn

Details for d2pkgc1

PDB Entry: 2pkg, 3.3 Å

PDB Description: Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40

PDB Compounds: (C:) Small T antigen

SCOPe Domain Sequences for d2pkgc1:

Sequence; same for both SEQRES and ATOM records:

>d2pkgc1 g.92.1.1 (C:91-170) Small t antigen, ST-AG {Simian virus 40 [TaxId: 10633]}
gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl
dlcegtlllwcdiigqttyr

Timeline for d2pkgc1:

• d2pkgc1 first appeared in SCOP 1.75
  
• d2pkgc1 appears in SCOPe 2.05
  
• d2pkgc1 appears in SCOPe 2.07
  
• d2pkgc1 appears in the current release, SCOPe 2.08