![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.92: T-antigen specific domain-like [161239] (1 superfamily) all-alpha zinc-binding domain; there are two zinc ion-binding sites with a common CxCxxC motif but different fourth ligands |
![]() | Superfamily g.92.1: T-antigen specific domain-like [161240] (1 family) ![]() automatically mapped to Pfam PF02380 |
![]() | Family g.92.1.1: T-antigen specific domain-like [161241] (1 protein) Pfam PF02380 |
![]() | Protein Small t antigen, ST-AG [161242] (1 species) |
![]() | Species Simian virus 40 [TaxId:10633] [161243] (1 PDB entry) Uniprot P03081 91-170 |
![]() | Domain d2pkgc1: 2pkg C:91-170 [145746] Other proteins in same PDB: d2pkga1, d2pkgb1 complexed with zn |
PDB Entry: 2pkg (more details), 3.3 Å
SCOPe Domain Sequences for d2pkgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkgc1 g.92.1.1 (C:91-170) Small t antigen, ST-AG {Simian virus 40 [TaxId: 10633]} gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl dlcegtlllwcdiigqttyr
Timeline for d2pkgc1: