SCOPe 2.07: Domain d2ozlc2: 2ozl C:1-361

Lineage for d2ozlc2 (2ozl C:1-361)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)

8. Domain d2ozlc2: 2ozl C:1-361 [145745]
   Other proteins in same PDB: d2ozla2, d2ozlb1, d2ozlb2, d2ozlb3, d2ozlc3, d2ozld1, d2ozld2, d2ozld3
   automated match to d1ni4a_
   complexed with k, mg, tpp

Details for d2ozlc2

PDB Entry: 2ozl, 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant

PDB Compounds: (C:) Pyruvate dehydrogenase E1 component alpha subunit, somatic form

SCOPe Domain Sequences for d2ozlc2:

Sequence; same for both SEQRES and ATOM records:

>d2ozlc2 c.36.1.11 (C:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghemsdpgvsyrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

Timeline for d2ozlc2:

• d2ozlc2 first appeared in SCOP 1.75, called d2ozlc1
  
• d2ozlc2 appears in SCOPe 2.06
  
• d2ozlc2 appears in the current release, SCOPe 2.08