Lineage for d2ozbe_ (2ozb E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014351Fold a.183: Nop domain [89123] (1 superfamily)
    multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain
  4. 2014352Superfamily a.183.1: Nop domain [89124] (2 families) (S)
  5. 2014353Family a.183.1.1: Nop domain [89125] (2 protein domains)
    putative snoRNA binding domain
  6. 2014357Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (1 species)
    contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam o8060
  7. 2014358Species Human (Homo sapiens) [TaxId:9606] [158763] (1 PDB entry)
    Uniprot Q8WWY3 85-333
  8. 2014360Domain d2ozbe_: 2ozb E: [145743]
    Other proteins in same PDB: d2ozba1, d2ozbd1
    automated match to d2ozbb1
    protein/RNA complex; complexed with ca

Details for d2ozbe_

PDB Entry: 2ozb (more details), 2.6 Å

PDB Description: structure of a human prp31-15.5k-u4 snrna complex
PDB Compounds: (E:) U4/U6 small nuclear ribonucleoprotein Prp31

SCOPe Domain Sequences for d2ozbe_:

Sequence, based on SEQRES records: (download)

>d2ozbe_ a.183.1.1 (E:) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]}
eaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgn
sldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhri
yeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllgaqrktlsgfss
tsvlphtgyiyhsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdei
erkfdkwqe

Sequence, based on observed residues (ATOM records): (download)

>d2ozbe_ a.183.1.1 (E:) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]}
eaapeyrvivdannltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgn
sldkcknnenlqqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhri
yeyvesrmsfiapnlsiiigastaakimgvaggltnlskmpacnimllgaqrsvlphtgy
iyhsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqe

SCOPe Domain Coordinates for d2ozbe_:

Click to download the PDB-style file with coordinates for d2ozbe_.
(The format of our PDB-style files is described here.)

Timeline for d2ozbe_: