Lineage for d2oyic1 (2oyi C:142-394)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002836Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 3002837Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 3002882Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 3002896Domain d2oyic1: 2oyi C:142-394 [145740]
    Other proteins in same PDB: d2oyia1, d2oyic2, d2oyid1
    automatically matched to 2OYH C:142-394
    complexed with ca

Details for d2oyic1

PDB Entry: 2oyi (more details), 2.7 Å

PDB Description: crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d2oyic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyic1 d.171.1.1 (C:142-394) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgdapsakfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlti

SCOPe Domain Coordinates for d2oyic1:

Click to download the PDB-style file with coordinates for d2oyic1.
(The format of our PDB-style files is described here.)

Timeline for d2oyic1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyic2