![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen gamma chain [88898] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
![]() | Domain d2oyhc2: 2oyh C:96-141 [145739] Other proteins in same PDB: d2oyha1, d2oyhc1, d2oyhd1 complexed with ca, fuc, nag; mutant |
PDB Entry: 2oyh (more details), 2.4 Å
SCOP Domain Sequences for d2oyhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyhc2 h.1.8.1 (C:96-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d2oyhc2: