SCOPe 2.06: Domain d2oyhc1: 2oyh C:142-394

Lineage for d2oyhc1 (2oyh C:142-394)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
   automatically mapped to Pfam PF00147

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
   Uniprot P02679

8. Domain d2oyhc1: 2oyh C:142-394 [145738]
   Other proteins in same PDB: d2oyha1, d2oyhc2, d2oyhd1
   complexed with ca

Details for d2oyhc1

PDB Entry: 2oyh, 2.4 Å

PDB Description: crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d2oyhc1:

Sequence; same for both SEQRES and ATOM records:

>d2oyhc1 d.171.1.1 (C:142-394) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgdapsakfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlti

Timeline for d2oyhc1:

• d2oyhc1 first appeared in SCOP 1.75
  
• d2oyhc1 appears in SCOPe 2.05
  
• d2oyhc1 appears in SCOPe 2.07
  
• d2oyhc1 appears in the current release, SCOPe 2.08