Lineage for d2otjg1 (2otj G:12-73)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900578Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 900579Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 900580Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 900581Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 900582Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 900603Domain d2otjg1: 2otj G:12-73 [145728]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to 1VQ4 G:12-73
    complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjg1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (G:) 50S ribosomal protein L10e

SCOP Domain Sequences for d2otjg1:

Sequence, based on SEQRES records: (download)

>d2otjg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d2otjg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d2otjg1:

Click to download the PDB-style file with coordinates for d2otjg1.
(The format of our PDB-style files is described here.)

Timeline for d2otjg1: