Lineage for d2ot3b1 (2ot3 B:17-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867411Protein Rab21 [142285] (1 species)
  7. 2867412Species Human (Homo sapiens) [TaxId:9606] [142286] (3 PDB entries)
    Uniprot Q9UL25 16-182
  8. 2867415Domain d2ot3b1: 2ot3 B:17-182 [145726]
    Other proteins in same PDB: d2ot3a_

Details for d2ot3b1

PDB Entry: 2ot3 (more details), 2.1 Å

PDB Description: crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
PDB Compounds: (B:) Ras-related protein Rab-21

SCOPe Domain Sequences for d2ot3b1:

Sequence, based on SEQRES records: (download)

>d2ot3b1 c.37.1.8 (B:17-182) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmie

Sequence, based on observed residues (ATOM records): (download)

>d2ot3b1 c.37.1.8 (B:17-182) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycttlqasfltkklniggkrvnlaiwdtagqerfhalg
piyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
eaesyaesvgakhyhtsakqnkgieelfldlckrmie

SCOPe Domain Coordinates for d2ot3b1:

Click to download the PDB-style file with coordinates for d2ot3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ot3b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ot3a_