Lineage for d2ok0l1 (2ok0 L:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782864Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity
    Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR
    Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1
    Uniprot P01642 21-115 #
    KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 782882Domain d2ok0l1: 2ok0 L:1-107 [145722]
    Other proteins in same PDB: d2ok0h1, d2ok0l2
    automatically matched to 2OJZ L:1-107

Details for d2ok0l1

PDB Entry: 2ok0 (more details), 1.89 Å

PDB Description: Fab ED10-DNA complex
PDB Compounds: (L:) Fab ED10 light chain

SCOP Domain Sequences for d2ok0l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok0l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevk

SCOP Domain Coordinates for d2ok0l1:

Click to download the PDB-style file with coordinates for d2ok0l1.
(The format of our PDB-style files is described here.)

Timeline for d2ok0l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ok0l2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ok0h1