SCOPe 2.06: Domain d2o97b1: 2o97 B:1-90

Lineage for d2o97b1 (2o97 B:1-90)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein HU protein [47735] (5 species)

7. Species Escherichia coli, beta-isoform [TaxId:562] [158508] (2 PDB entries)
   Uniprot P0ACF4 1-90
   HupB

8. Domain d2o97b1: 2o97 B:1-90 [145717]
   heterodimer with alpha-isoform
   complexed with cl, ni

Details for d2o97b1

PDB Entry: 2o97, 2.45 Å

PDB Description: crystal structure of e. coli hu heterodimer

PDB Compounds: (B:) DNA-binding protein HU-beta

SCOPe Domain Sequences for d2o97b1:

Sequence, based on SEQRES records:

>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]}
mnksqlidkiaagadiskaaagraldaiiasvteslkegddvalvgfgtfavkeraartg
rnpqtgkeitiaaakvpsfragkalkdavn

Sequence, based on observed residues (ATOM records):

>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]}
mnksqlidkiaagadskaaagraldaiiasvteslkegddvalvgfgtfavkerakvpsf
ragkalkdavn

Timeline for d2o97b1:

• d2o97b1 first appeared in SCOP 1.75
  
• d2o97b1 appears in SCOPe 2.05
  
• d2o97b1 appears in SCOPe 2.07
  
• d2o97b1 appears in the current release, SCOPe 2.08