Lineage for d2o6vh_ (2o6v H:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402319Protein Ubiquitin [54238] (7 species)
  7. 1402386Species Human (Homo sapiens) [TaxId:9606] [54239] (99 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 1402485Domain d2o6vh_: 2o6v H: [145716]
    Other proteins in same PDB: d2o6vb_, d2o6vf_
    automated match to d2o6vd1
    complexed with mes, so4

Details for d2o6vh_

PDB Entry: 2o6v (more details), 2.2 Å

PDB Description: Crystal structure and solution NMR studies of Lys48-linked tetraubiquitin at neutral pH
PDB Compounds: (H:) Ubiquitin

SCOPe Domain Sequences for d2o6vh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6vh_ d.15.1.1 (H:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
qifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyni
qrestlhlvlrlrgg

SCOPe Domain Coordinates for d2o6vh_:

Click to download the PDB-style file with coordinates for d2o6vh_.
(The format of our PDB-style files is described here.)

Timeline for d2o6vh_: