Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins) the core motif is inserted in a six-stranded meander beta-sheet domain |
Protein Nuclease NucA [159863] (1 species) |
Species Anabaena sp., PCC 7120 [TaxId:103690] [159864] (1 PDB entry) Uniprot P38446 35-274 |
Domain d2o3ba1: 2o3b A:35-274 [145714] Other proteins in same PDB: d2o3bb1 complexed with mes, mg, ni; mutant |
PDB Entry: 2o3b (more details), 2.3 Å
SCOP Domain Sequences for d2o3ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3ba1 d.4.1.2 (A:35-274) Nuclease NucA {Anabaena sp., PCC 7120 [TaxId: 1167]} sisvhlllgnpsgatptkltpdnylmvknqyalsynnskgtanwvawqlnsswlgnaerq dnfrpdktlpagwvrvtpsmysgsgyarghiapsadrtkttednaatflmtnmmpqtpdn nrntwgnledycrelvsqgkelyivagpngslgkplkgkvtvpkstwkivvvldspgsgl egitantrviavnipndpelnndwraykvsvdelesltgydflsnvspniqtsieskvdn
Timeline for d2o3ba1: