Lineage for d2o39b1 (2o39 B:129-325)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793517Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 793518Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) (S)
  5. 793519Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 793520Protein Adenovirus fiber protein "knob" domain [49837] (7 species)
  7. 793540Species Human adenovirus type 11P [TaxId:343462] [158980] (1 PDB entry)
    Uniprot P35774 129-325
  8. 793542Domain d2o39b1: 2o39 B:129-325 [145713]
    Other proteins in same PDB: d2o39c1, d2o39c2, d2o39d1, d2o39d2
    automatically matched to 2O39 A:129-325
    complexed with bma, ca, nag

Details for d2o39b1

PDB Entry: 2o39 (more details), 2.85 Å

PDB Description: human adenovirus type 11 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)
PDB Compounds: (B:) fiber protein

SCOP Domain Sequences for d2o39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o39b1 b.21.1.1 (B:129-325) Adenovirus fiber protein "knob" domain {Human adenovirus type 11P [TaxId: 343462]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

SCOP Domain Coordinates for d2o39b1:

Click to download the PDB-style file with coordinates for d2o39b1.
(The format of our PDB-style files is described here.)

Timeline for d2o39b1: