![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein) |
![]() | Protein Adenovirus fiber protein "knob" domain [49837] (7 species) |
![]() | Species Human adenovirus type 11P [TaxId:343462] [158980] (1 PDB entry) Uniprot P35774 129-325 |
![]() | Domain d2o39b1: 2o39 B:129-325 [145713] Other proteins in same PDB: d2o39c1, d2o39c2, d2o39d1, d2o39d2 automatically matched to 2O39 A:129-325 complexed with bma, ca, nag |
PDB Entry: 2o39 (more details), 2.85 Å
SCOP Domain Sequences for d2o39b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o39b1 b.21.1.1 (B:129-325) Adenovirus fiber protein "knob" domain {Human adenovirus type 11P [TaxId: 343462]} dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa ttlvtspftfyyiredd
Timeline for d2o39b1: